HPA011157
Anti-LAT antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonyme(s) :
Anti-36 kDa phospho-tyrosine adapter protein antibody produced in rabbit, Anti-Linker for activation of T-cells family member 1 antibody produced in rabbit, Anti-p36-38 antibody produced in rabbit, Anti-pp36 antibody produced in rabbit
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Numéro MDL:
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.43
Source biologique
rabbit
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Gamme de produits
Prestige Antibodies® Powered by Atlas Antibodies
Forme
buffered aqueous glycerol solution
Espèces réactives
human
Validation améliorée
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
Technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
Séquence immunogène
HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... SPNS1(83985)
Description générale
LAT (linker for activation of T cells) is a leukocyte type III transmembrane adaptor protein. It is made of 262 amino acids, and has a shorter isoform made of 233 amino acids. It is a lipid raft associated protein, and does so by its two cysteine residues present proximal to the membrane. This protein resides in the plasma membrane as well as intracellular and subsynaptic vesicles. It has a small exoplasmic region, a single membrane spanning domain, and a cytoplasmic region containing nine tyrosine residues. This gene maps to human chromosome 16p11.2, spans 5.7kb and has 11 exons.
Immunogène
Linker for activation of T-cells family member 1 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Actions biochimiques/physiologiques
LAT (linker for activation of T cells) plays an essential role in the development and activation of T-cells, and T-cell receptor (TCR) signaling. Phosphorylated Zap-70 (Zeta-chain-associated protein kinase 70) phosphorylates the tyrosine residues of LAT. This activated LAT then initiates TCR-signaling. Activated LAT induces multiple signaling intermediates, leading to Ca2+ influx, activation of NFAT (nuclear factor of activated T cells), which eventually leads to the activation of cytokines. It regulates the proliferation of lymphocytes, and controls the differentiation of T-cells into T-helper 1 (Th1) and Th2 subtypes. Activation of natural killer (NK) cells, lead to the phosphorylation and activation of LAT, which in turn interacts with various phosphotyrosine containing proteins, such as PCLγ (phospholipase Cγ). This leads to an overall increase in the cytotoxic function of NK cells. LAT is overexpressed in severe aplastic anemia (SAA), where up-regulated LAT might lead to increased activity of T-cells, and disruption of Th1/Th2 balance.
Caractéristiques et avantages
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Liaison
Corresponding Antigen APREST72225
Forme physique
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informations légales
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Not finding the right product?
Try our Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 1
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Équipement de protection individuelle
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
David J Williamson et al.
Nature immunology, 12(7), 655-662 (2011-06-07)
Engaged T cell antigen receptors (TCRs) initiate signaling through the adaptor protein Lat. In quiescent T cells, Lat is segregated into clusters on the cell surface, which raises the question of how TCR triggering initiates signaling. Using super-resolution fluorescence microscopy
Naoki Kunii et al.
Human gene therapy, 24(1), 27-37 (2012-09-25)
It is likely that the enhancement of signaling after antigenic stimulation, particularly in the tumor microenvironment, would improve the function of adoptively transferred T cells. Linker for activation of T cells (LAT) plays a central role in T cell activation.
Václav Horejsí et al.
The FEBS journal, 277(21), 4383-4397 (2010-09-30)
Membrane rafts are microdomains involved in a number of biologically important processes, including immunoreceptor signalling. Among the functionally important protein components of these microdomains are transmembrane adaptor proteins, containing in their intracellular domains tyrosine residues that can be phosphorylated and
C Windpassinger et al.
Cytogenetic and genome research, 97(3-4), 155-157 (2002-11-20)
We have mapped the LAT gene by radiation hybrid mapping and fluorescence in situ hybridization to chromosome 16p11.2. The complete cDNA sequence of LAT was generated using assembled sequences of cDNA fragments already available. BLAST analysis using the cDNA sequence
Lakshmi Balagopalan et al.
Journal of immunology (Baltimore, Md. : 1950), 190(8), 3849-3853 (2013-03-15)
A controversy has recently emerged regarding the location of the cellular pool of the adapter linker for activation of T cells (LAT) that participates in propagation of signals downstream of the TCR. In one model phosphorylation and direct recruitment of
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique