Accéder au contenu
MilliporeSigma
Toutes les photos(7)

Principaux documents

HPA008874

Sigma-Aldrich

Anti-FDFT1 antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-FPP:FPP farnesyltransferase antibody produced in rabbit, Anti-Farnesyl-diphosphate farnesyltransferase antibody produced in rabbit, Anti-SQS antibody produced in rabbit, Anti-SS antibody produced in rabbit, Anti-Squalene synthetase antibody produced in rabbit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
827,00 $

827,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μL
827,00 $

About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.43

827,00 $


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

Séquence immunogène

PEEFYNLVRFRIGGKRKVMPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICR

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... FDFT1(2222)

Description générale

FDFT1 (farnesyl-diphosphate farnesyltransferase 1) is also known as squalene synthase (SS), and is an essential enzyme of the cholesterol biogenesis pathway. This protein has a putative molecular weight of 48,041 and is composed of 417 amino acids. Two variants of FDFT1 mRNA are found in humans, which differ at their 3′ untranslated regions. They are of 2kb and 1.55kb and are equally expressed in heart, lung, liver, kidney, pancreas and placenta. However, the 2kb transcript is abundant in heart and skeletal muscle.

Immunogène

Squalene synthetase recombinant protein epitope signature tag (PrEST)

Application

Anti-FDFT1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

FDFT1 (farnesyl-diphosphate farnesyltransferase 1) enzyme catalyzes the first committed reaction in steroid/hopanoid pathways. It catalyzes the conversion of two farnesyl diphosphates (FPPs) into squalene. It is also thought to be involved in carotenoid biosynthesis, where it might be responsible for the production of carotenoid dehydrosqualene. It determines the fate towards sterol synthesis. In prostate cancer cells, its expression is elevated by androgens, which are mevalonate/isoprenoid pathway intermediates which facilitate cholesterol synthesis. Thus, this enzyme might be implicated in cholesterol synthesis in cancer cells, and might be a therapeutic target for antineoplastic strategies. In chronic hepatitis C (CHC) patients, this protein is linked with advanced fibrosis in non-steatotic subgroup. Overexpression of FDFT1 results in elevated activation of tumor necrosis factor (TNF)-α receptor 1 and nuclear factor (NF)-κB pathways and increased expression of MMP (matrix metallopeptidase) 1, which in turn facilitates the metastasis of lung cancer.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86797

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Maiko Furubayashi et al.
FEBS letters, 588(3), 436-442 (2013-12-18)
The first committed steps of steroid/hopanoid pathways involve squalene synthase (SQS). Here, we report the Escherichia coli production of diaponeurosporene and diapolycopene, yellow C30 carotenoid pigments, by expressing human SQS and Staphylococcus aureus dehydrosqualene (C30 carotenoid) desaturase (CrtN). We suggest
Albert F Stättermayer et al.
Liver international : official journal of the International Association for the Study of the Liver, 34(3), 388-395 (2013-07-23)
In chronic hepatitis C (CHC), steatosis is associated with fibrosis and impaired response to antiviral therapy. Recently, a polymorphism of single nucleotide polymorphism SNP rs2645424 of farnesyl diphosphate farnesyl transferase 1 (FDFT1) was identified in NAFLD/NASH as a possible causal
Koen Brusselmans et al.
The Journal of biological chemistry, 282(26), 18777-18785 (2007-05-08)
Several cues for cell proliferation, migration, and survival are transmitted through lipid rafts, membrane microdomains enriched in sphingolipids and cholesterol. Cells obtain cholesterol from the circulation but can also synthesize cholesterol de novo through the mevalonate/isoprenoid pathway. This pathway, however
C Summers et al.
Gene, 136(1-2Che), 185-192 (1993-12-22)
The reaction catalysed by squalene synthase (SQS) shows many similarities to that performed by another polyisoprene synthase, phytoene synthase (PhS). By identifying sequences conserved between yeast SQS (ySQS) and PhS, we have cloned a 2-kb cDNA (hSQS) encoding human SQS
Yi-Fang Yang et al.
American journal of respiratory and critical care medicine, 190(6), 675-687 (2014-08-26)
Metabolic alterations contribute to cancer development and progression. However, the molecular mechanisms relating metabolism to cancer metastasis remain largely unknown. To identify a key metabolic enzyme that is aberrantly overexpressed in invasive lung cancer cells and to investigate its functional

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique