HPA008129

Anti-FMNL1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-CLL-associated antigen KW-13, Anti-Formin-like protein 1, Anti-Leukocyte formin
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA008129
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Séquence immunogène: LHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFS
• Numéro d'accès UniProt: O95466
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... FMNL1(752)

Description

Description générale

Formins contain a conserved formin homology 2 (FH2) domain that is essential for dimerization and subsequent actin filament assembly. N-terminal to this domain is the formin homology 1 (FH1) domain that functions in the physiological action of formins by recruiting profilin-bound actin monomers to the growing actin filament. FMNL1 contains a GTPase binding domain (GBD) and a diaphanous autoregulatory domain (DAD), additionally.

Immunogène

Formin-like protein 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-FMNL1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

FMNL1 (formin-like 1) gene encodes a leukocyte formin that has been found to be overexpressed in lymphomas. FMNL1 is a member of the diaphanous-related formins (DRFs) that are activated by Rho GTPase binding to the GBD (GTPase binding domain). Formins are large multi-domain proteins that function in the polymerization of unbranched actin filaments and regulate cytoskeletal dynamics. They also function in the maintenance of cell polarity, adhesion and migration. The Rho GTPases, Rac1 and RhoA, are involved in the binding and activation of FMNL1.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST70052

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable