Toutes les photos(9)

Documents

HPA004201

Anti-DAZAP1 antibody produced in rabbit

Name: Anti-DAZAP1 antibody produced in rabbit
Brand: SIGMA

Ab1, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-DAZ-associated protein 1 antibody produced in rabbit, Anti-Deleted in azoospermia-associated protein 1 antibody produced in rabbit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Toutes les photos(9)

About This Item

Code UNSPSC :

12352203

Numéro HPA (Human Protein Atlas):

HPA004201

Nomenclature NACRES :

NA.43

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies^® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

rat, mouse, human

Validation améliorée

orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Séquence immunogène

EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA

Numéro d'accès UniProt

Q96EP5

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... DAZAP1(26528)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Description générale

DAZAP1 is an RNA-binding protein localized in the nucleus and transports between nucleus and cytoplasm via a ZNS shuttling signal presents in C-terminus. It is highly expressed in testes and dominant expression has found in late stage spermatocytes and post-meiotic spermatids.

Immunogène

DAZ-associated protein 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

DAZAP1 (DAZ-associated protein 1) is majorly involved in RNA transcription, splicing, and translation. It forms a complex to participates in the degradation and silencing of mRNA. It can activate translation process by accelerating translation initiation step. Actinomycin D inhibits the RNA polymerase II activity which results in DAZAP1 accumulation in cytoplasm. It has been concluded that DAZAP1 needs N-terminal signals for nuclear localization.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86900

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Deferoxamine mesylate improves splicing and GAA activity of the common c.-32-13T>G allele in late-onset PD patient fibroblasts.

Emanuele Buratti et al.

Molecular therapy. Methods & clinical development, 20, 227-236 (2021-01-12)

Pompe disease (PD) is an autosomal recessive lysosomal storage disorder due to deficient activity of the acid alpha glucosidase enzyme (GAA). As a consequence of the enzymatic defect, undigested glycogen accumulates within lysosomes. Most patients affected by the late-onset (LO)

Differential translation of Dazap1 transcripts during spermatogenesis.

Chi-Kai Yang et al.

PloS one, 8(4), e60873-e60873 (2013-05-10)

Deleted in AZoospermia Associated Protein 1 (DAZAP1) is a ubiquitous hnRNP protein that has been implicated in RNA transcription, splicing, and translation. It is highly expressed in testes, predominantly in late stage spermatocytes and post-meiotic spermatids. Dazap1 deficiency in mice

DAZAP1 interacts via its RNA-recognition motifs with the C-termini of other RNA-binding proteins.

Huei-Ting Yang et al.

Biochemical and biophysical research communications, 380(3), 705-709 (2009-03-17)

The turnover and translation of many human mRNAs is regulated by AU-rich elements present in their 3?untranslated region, which bind various trans acting factors. We previously identified a trans acting factor that interacts with these cis elements as DAZAP1 (deleted

Transcription-dependent nuclear localization of DAZAP1 requires an N-terminal signal.

Yi-Tzu Lin et al.

Biochemical and biophysical research communications, 428(3), 422-426 (2012-11-01)

Deleted in Azoospermia Associated Protein 1 (DAZAP1) is a ubiquitous hnRNP protein required for normal development and spermatogenesis. It resides predominantly in the nucleus and moves between the nucleus and the cytoplasm via a ZNS shuttling signal at its C-terminus.

DAZAP1, an RNA-binding protein required for development and spermatogenesis, can regulate mRNA translation.

Richard W P Smith et al.

RNA (New York, N.Y.), 17(7), 1282-1295 (2011-05-18)

DAZ-associated protein 1 (DAZAP1) is an RNA-binding protein required for normal growth, development, and fertility in mice. However, its molecular functions have not been elucidated. Here we find that Xenopus laevis and human DAZAP1, which are each expressed as short

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique