Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Documents

AV54278

Sigma-Aldrich

Anti-ACAT1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-ACAT, Anti-Acetyl-coenzyme A acetyltransferase 1 (acetoacetyl coenzyme A thiolase), Anti-MAT, Anti-T2, Anti-THIL

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(2)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

41 kDa

Espèces réactives

rat, human, horse, guinea pig, dog, rabbit, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_000010

Numéro d'accès UniProt

P35610

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ACAT1(38)

Immunogène

Synthetic peptide directed towards the middle region of human ACAT1

Application

Anti-ACAT1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Actions biochimiques/physiologiques

ACAT1 gene encodes a mitochondrial enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. It also facilitates the lipoprotein assembly and dietary cholesterol absorption. In addition to its acyltransferase activity, it also catalyzes the esterification of 24(S)-hydroxycholesterol (24S-OHC), which results in lipid droplet formation and induces 24S-OHC-mediated apoptosis. Furthermore, ACAT1 expression also serves as a potent prognostic marker for prostate cancer.

Séquence

Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

K Yamanaka et al.
Cell death & disease, 5, e990-e990 (2014-01-11)
24(S)-hydroxycholesterol (24S-OHC), which is enzymatically produced in the brain, has an important role in maintaining brain cholesterol homeostasis. We have previously reported that 24S-OHC induces necroptosis in human neuroblastoma SH-SY5Y cells. In the present study, we investigated the mechanisms by
Naomi Sakashita et al.
The journal of medical investigation : JMI, 61(3-4), 270-277 (2014-09-30)
Macrophages in hyperlipidemic conditions accumulate cholesterol esters and develop into foamy transformed macrophages. During this transformation, macrophages demonstrate endoplasmic reticulum fragmentation and consequently produce acyl coenzyme A: cholesterol acyltransferase 1 (ACAT1)-positive late endosomes (ACAT1-LE). ACAT1-LE-positive macrophages effectively esterify modified or
Punit Saraon et al.
The Prostate, 74(4), 372-380 (2013-12-07)
Prostate cancer is the second leading cause of cancer-related death among men in North America. While a majority of prostate cancer cases remain indolent, subsets of patients develop aggressive cancers, which may lead to death. The current methods of detection
Liliana M R Silva et al.
Scientific reports, 9(1), 6650-6650 (2019-05-02)
Besnoitia besnoiti, an apicomplexan parasite of cattle being considered as emergent in Europe, replicates fast in host endothelial cells during acute infection and is in considerable need for energy, lipids and other building blocks for offspring formation. Apicomplexa are generally
Guang-Jing Hu et al.
Cell research, 23(8), 1007-1024 (2013-07-10)
Trans-splicing, a process involving the cleavage and joining of two separate transcripts, can expand the transcriptome and proteome in eukaryotes. Chimeric RNAs generated by trans-splicing are increasingly described in literatures. The widespread presence of antibiotic resistance genes in natural environments
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique