Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV54274

Sigma-Aldrich

Anti-ATG10 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-APG10, Anti-APG10L, Anti-ATG10 autophagy related 10 homolog (S. cerevisiae), Anti-DKFZP586I0418, Anti-FLJ13954, Anti-Pp12616

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
725,00 $

725,00 $

Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.
Toutes les photos(1)

Sélectionner une taille de conditionnement

Changer de vue
100 μL
725,00 $

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

725,00 $

Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

25 kDa

Espèces réactives

mouse, rat, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_113670

Numéro d'accès UniProt

Q9H0Y0

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ATG10(83734)

Catégories apparentées

Description générale

ATG10 [autophagy related 10 homolog (S. cerevisiae)] or APG10 gene encodes a protein necessary for autophagy in yeast. Autophagy is a catabolic cellular event that includes cell death of superfluous or dysfunctional cellular components, cell differentiation and aging. It is also crucial for the maintenance of amino acid levels and protein synthesis under nitrogen starvation and is enhanced under certain conditions such as hormonal stimulation and drug treatments.

Immunogène

Synthetic peptide directed towards the C terminal region of human ATG10

Application

Anti-ATG10 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Actions biochimiques/physiologiques

Atg10 is an E2-like enzyme that facilitates the addition of ubiquitination modifications essential for autophagosome formation. It catalyzes the conjugation of ATG12 to ATG5, which is essential for proper localization of ATG8 to the preautophagosomal structure (PAS). Further, Atg10 also plays a role in modifying the soluble form of LC3 to the membrane-bound form during Atg12 conjugation.

Séquence

Synthetic peptide located within the following region: TPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
QC22544

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

N Mizushima et al.
Nature, 395(6700), 395-398 (1998-10-06)
Autophagy is a process for the bulk degradation of proteins, in which cytoplasmic components of the cell are enclosed by double-membrane structures known as autophagosomes for delivery to lysosomes or vacuoles for degradation. This process is crucial for survival during
[The nurse; cancerology and radiotherapy].
C Chenal et al.
Revue de l'infirmiere, 26(8), 686-695 (1976-10-01)
Miao-Qing Zhang et al.
Frontiers in immunology, 9, 2176-2176 (2018-10-16)
Autophagy-related 10 (ATG10) is essential for autophagy since it promotes ATG5-ATG12 complex formation. Our previous study found that there are two isoforms of the ATG10 protein, ATG10 (a longer one) and ATG10S, which have identical sequences except an absence of
Takahiro Nemoto et al.
The Journal of biological chemistry, 278(41), 39517-39526 (2003-08-02)
Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes/vacuoles. The formation of autophagosomes involves a dynamic rearrangement of the membrane for which two ubiquitin-like modifications (the conjugation of Apg12p and the modification of a soluble form

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique