Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Key Documents

AV49979

Sigma-Aldrich

Anti-UNC93B1 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-MGC126617, Anti-UNC93, Anti-UNC93B, Anti-Unc-93 homolog B1 (C. elegans)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

67 kDa

Espèces réactives

bovine, horse, mouse, guinea pig, human, dog, rat

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_112192

Numéro d'accès UniProt

Q9H1C4

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... UNC93B1(81622)

Immunogène

Synthetic peptide directed towards the N terminal region of human UNC93B1

Application

Anti-UNC93B1 antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.

Actions biochimiques/physiologiques

Unc-93 homolog B1 (UNC93B1) is a transmembrane protein localized to the plasma membrane. It is involved in the trafficking of nucleic acid-sensing toll-like receptors (TLR) from endoplasmic reticulum to the endolysosomes. It regulates both innate and adaptive immune responses by regulating TLR signaling.

Séquence

Synthetic peptide located within the following region: LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Bettina L Lee et al.
eLife, 2, e00291-e00291 (2013-02-22)
UNC93B1, a multipass transmembrane protein required for TLR3, TLR7, TLR9, TLR11, TLR12, and TLR13 function, controls trafficking of TLRs from the endoplasmic reticulum (ER) to endolysosomes. The mechanisms by which UNC93B1 mediates these regulatory effects remain unclear. Here, we demonstrate
Bruno Luiz Fonseca Schamber-Reis et al.
The Journal of biological chemistry, 288(10), 7127-7136 (2013-01-18)
The mammalian homolog B1 of Unc-93 Caenorhabditis elegans known as UNC93B1 is a chaperone protein that mediates translocation of the nucleic acid-sensing Toll-like receptors (TLRs) from the endoplasmic reticulum to the endolysosomes. The triple deficient (UNC93B1 mutant) mice have a
Jelka Pohar et al.
PloS one, 9(3), e92391-e92391 (2014-03-22)
Toll-like receptor 3 (TLR3) is a dsRNA sensing receptor that is localized in the cellular compartments but also at the plasma membrane. Overexpression of UNC93B1 promoted localization of TLR3, but not other nucleic acid sensing TLRs, to the plasma membrane.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique