AV48526

Anti-TRMT11 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-C6orf75, Anti-MDS024, Anti-TRM11, Anti-dJ187J11, Anti-dJ187J11.2, Anti-tRNA methyltransferase 11 homolog (S. cerevisiae)
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 53 kDa
• Espèces réactives: human, mouse, horse, bovine, dog, rabbit, rat, guinea pig
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_001026882
• Numéro d'accès UniProt: Q7Z4G4
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TRMT11(60487)

Description

Description générale

TRMT11-1 codes for tRNA Methyltransferase 11 homolog (S. cerevisiae). It may be involved in the processing of tRNA. Genetic variation in TRMT11 has been analyzed as a biomarker to predict the efficacy of androgen deprivation therapy in prostate cancer patients.
Rabbit Anti-TRMT11 antibody recognizes human, mouse, rat, chicken, canine, and bovine TRMT11.

Immunogène

Synthetic peptide directed towards the N terminal region of human TRMT11

Application

Rabbit Anti-TRMT11 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Actions biochimiques/physiologiques

TRMT11 belongs to the methyltransferase superfamily. It is a catalytic subunit of an S-adenosyl-L-methionine-dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs.

Séquence

Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable