Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV46887

Sigma-Aldrich

Anti-TSPAN12 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-NET-2, Anti-TM4SF12, Anti-Tetraspanin 12

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

35 kDa

Espèces réactives

mouse, dog, guinea pig, rat, bovine, horse, human, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TSPAN12(23554)

Immunogène

Synthetic peptide directed towards the middle region of human TSPAN12

Application

Anti-LETM1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL.

Actions biochimiques/physiologiques

TSPAN12 (tetraspanin 12) gene encodes a multi-pass membrane protein that belongs to tetraspanin family. TSPAN12 interacts with ADAM10 and stimulates its maturation and thereby facilitates ADAM10-dependent proteolysis of amyloid precursor protein (APP). In cancer cells, knockdown of TSPAN12 decreases membrane type-1 matrix metalloproteinase (MT1-MMP) proteolytic functions. Mutation in TSPAN12 gene results in autosomal-dominant familial exudative vitreoretinopathy.

Séquence

Synthetic peptide located within the following region: EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

12 - Non Combustible Liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Guohua Ji et al.
Molecules and cells, 42(7), 557-567 (2019-08-01)
TSPAN12, a member of the tetraspanin family, has been highly connected with the pathogenesis of cancer. Its biological function, however, especially in ovarian cancer (OC), has not been well elucidated. In this study, The Cancer Genome Atlas (TCGA) dataset analysis
Daosong Xu et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 23(11), 3674-3681 (2009-07-10)
Using mass spectrometry, we identified ADAM10 (a membrane-associated metalloproteinase) as a partner for TSPAN12, a tetraspanin protein. TSPAN12-ADAM10 interaction was confirmed by reciprocal coimmunoprecipitation in multiple tumor cell lines. TSPAN12, to a greater extent than other tetraspanins (CD81, CD151, CD9
James A Poulter et al.
American journal of human genetics, 86(2), 248-253 (2010-02-18)
Familial exudative vitreoretinopathy (FEVR) is an inherited blinding disorder of the retinal vascular system. Although mutations in three genes (LRP5, FZD4, and NDP) are known to cause FEVR, these account for only a fraction of FEVR cases. The proteins encoded
Marc A Lafleur et al.
Molecular biology of the cell, 20(7), 2030-2040 (2009-02-13)
Membrane type-1 matrix metalloproteinase (MT1-MMP) supports tumor cell invasion through extracellular matrix barriers containing fibrin, collagen, fibronectin, and other proteins. Here, we show that simultaneous knockdown of two or three members of the tetraspanin family (CD9, CD81, and TSPAN12) markedly

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique