AV46773

Anti-SC4MOL antibody produced in rabbit

IgG fraction of antiserum

• Synonyme(s) : Anti-DESP4, Anti-ERG25, Anti-MGC104344, Anti-Sterol-C4-methyloxidase-like
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: IgG fraction of antiserum
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 35 kDa
• Espèces réactives: pig, rabbit, dog, human, horse, mouse
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_006736
• Numéro d'accès UniProt: Q15800
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... SC4MOL(6307)

Description

Description générale

Sterol-C4-methyloxidase-like/methylsterol monooxygenase 1 (SC4MOL, DESP4, ERG25, MSMO1) is an endoplasmic reticulum enzyme that catalyzes the demethylation of C4-methlysterols (meiosis-activating sterols, MAS) in the cholesterol synthesis pathway. Defective/mutated SC4MOL contributes to psoriasiform dermatitis, microcephaly, and developmental delay.

Spécificité

Anti-SC4MOL polyclonal antibody reacts with zebrafish, bovine, pig, human, mouse, rat, and canine sterol-C4-methyloxidase-like proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human SC4MOL

Application

Anti-SC4MOL polyclonal antibody is used to tag sterol-C4-methyloxidase-like for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of sterol-C4-methyloxidase-like in the management of C4-methlysterols (meiosis-activating sterols, MAS) levels.

Actions biochimiques/physiologiques

Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases.Sterol-C4-mehtyl oxidase-like protein was isolated based on its similarity to the yeast ERG25 protein. It contains a set of putative metal binding motifs with similarity to that seen in a family of membrane desaturases-hydroxylases. The protein is localized to the endoplasmic reticulum membrane and is believed to function in cholesterol biosynthesis. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Séquence

Synthetic peptide located within the following region: MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable