Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Key Documents

AV46013

Sigma-Aldrich

Anti-PRIM1 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-MGC12308, Anti-Primase, polypeptide 1, 49 kDa, Anti-p49

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

50 kDa

Espèces réactives

rabbit, rat, guinea pig, bovine, human, horse, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_000937

Numéro d'accès UniProt

P49642

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PRIM1(5557)

Immunogène

Synthetic peptide directed towards the N terminal region of human PRIM1

Application

Anti-PRIM1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Actions biochimiques/physiologiques

Human DNA primase 1 (PRIM1) is a pivotal enzyme component of complex chromosomal replication apparatus. It functions in synchronization with DNA polymerase alpha during replication in eukaryotic cells. DNA primase facilitates the synthesis of small RNA primers that initiate synthesis of the lagging DNA strand.

Séquence

Synthetic peptide located within the following region: SQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKM

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

F Stadlbauer et al.
European journal of biochemistry, 222(3), 781-793 (1994-06-15)
DNA-polymerase-alpha--primase complex contains four subunits, p180, p68, p58, and p48, and comprises a minimum of two enzymic functions. We have cloned cDNAs encoding subunits of DNA-polymerase-alpha--primase from human and mouse. Sequence comparisons showed high amino acid conservation among the mammalian
Mairi L Kilkenny et al.
The Journal of biological chemistry, 287(28), 23740-23747 (2012-05-18)
The DNA polymerase α-primase complex forms an essential part of the eukaryotic replisome. The catalytic subunits of primase and pol α synthesize composite RNA-DNA primers that initiate the leading and lagging DNA strands at replication forks. The physical basis and

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique