Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Documents

AV45646

Sigma-Aldrich

Anti-NR4A3 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-CHN, Anti-CSMF, Anti-MINOR, Anti-NOR1, Anti-Nuclear receptor subfamily 4, group A, member 3, Anti-TEC

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

68 kDa

Espèces réactives

mouse, rat, rabbit, pig, human, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... NR4A3(8013)

Immunogène

Synthetic peptide directed towards the middle region of human NR4A3

Application

Anti-NR4A3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Actions biochimiques/physiologiques

Nuclear receptor subfamily 4, group A, member 3 (NR4A3; NOR1) is an orphan receptor belonging to the steroid-thyroid hormone-retinoid receptor superfamily. It binds the NGFI-B Response Element (NBRE) and acts as transcriptional activator. NR4A3 is a regulator of mast cell function, inflammation and insulin gene expression.

Séquence

Synthetic peptide located within the following region: KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Weina Gao et al.
PloS one, 9(3), e91462-e91462 (2014-03-19)
NR4A3/NOR-1 is a member of the NR4A orphan nuclear receptor subfamily, which contains early response genes that sense and respond to a variety of stimuli in the cellular environment. The role of NR4A3 in insulin expression in pancreatic beta cells
Gianni Garcia-Faroldi et al.
PloS one, 9(2), e89311-e89311 (2014-03-04)
Nuclear receptor 4a3 (Nr4a3) is a transcription factor implicated in various settings such as vascular biology and inflammation. We have recently shown that mast cells dramatically upregulate Nuclear receptor 4a3 upon activation, and here we investigated the functional impact of
Ankita Saini et al.
Scientific reports, 8(1), 2296-2296 (2018-02-06)
Mycobacterium tuberculosis instigates interactions with host factors to promote its survival within the host inimical conditions. Among such factors, nuclear receptors (NRs) seem to be promising candidates owing to their role in bacterial pathogenesis. However, only few members of NR
Takashi Nomiyama et al.
The Journal of biological chemistry, 281(44), 33467-33476 (2006-09-02)
Members of the nuclear hormone receptor superfamily function as key transcriptional regulators of inflammation and proliferation in cardiovascular diseases. In addition to the ligand-dependent peroxisome proliferator-activated receptors and liver X receptors, this family of transcription factors includes a large number

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique