Accéder au contenu
MilliporeSigma
Toutes les photos(4)

Documents

AV45437

Sigma-Aldrich

Anti-TAPBP antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-NGS17, Anti-TAP binding protein (tapasin), Anti-TAPA, Anti-TPN, Anti-TPSN

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(4)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

46 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

NP_003181

Numéro d'accès UniProt

O15533

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... TAPBP(6892)

Catégories apparentées

Immunogène

Synthetic peptide directed towards the C terminal region of human TAPBP

Application

Anti-TAPBP antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Actions biochimiques/physiologiques

TAP binding protein (TAPBP; tapasin) is a membrane glycoprotein that is involved in the transport of antigenic peptides across the endoplasmic membrane. The expression of tapasin is upregulated by potent inflammatory molecules such as eicosanoids. Downregulation of tapasin expression is associated with clinical outcome in primary human oral squamous cell carcinoma. Polymorphisms in TAPBP gene have been associated with the overall survival of colorectal cancer patients.

Séquence

Synthetic peptide located within the following region: GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Jiaofang Shao et al.
PloS one, 8(8), e70307-e70307 (2013-08-14)
Recent studies have demonstrated the power of deep re-sequencing of the whole genome or exome in understanding cancer genomes. However, targeted capture of selected genomic whole gene-body regions, rather than the whole exome, have several advantages: 1) the genes can
Sung-hwan Cho et al.
Pharmacogenetics and genomics, 23(7), 341-348 (2013-06-06)
Aspirin-exacerbated respiratory disease (AERD) is characterized by the development of airway obstruction in asthmatic individuals following the ingestion of aspirin or other nonsteroidal anti-inflammatory drugs. TAPBP (TAP-binding protein, tapasin) is upregulated by eicosanoids, which act as potent inflammatory molecules in
Qian Jiang et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 31(5), 451-459 (2010-06-10)
MHC class I peptide loading complex defects are frequently observed in tumor cells which facilitate tumor cells escaping from immune surveillance. Tapasin plays an important role in the assembly of MHC class I molecules with peptides in the endoplasmic reticulum.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique