Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Documents

AV35609

Sigma-Aldrich

Anti-TRPM3 (AB3) antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-GON-2, Anti-LTRPC3, Anti-MLSN2, Anti-Transient receptor potential cation channel, subfamily M, member 3

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Poids mol.

188 kDa

Espèces réactives

dog, mouse, human, guinea pig, bovine, rat, rabbit, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TRPM3(80036)

Immunogène

Synthetic peptide directed towards the N terminal region of human TRPM3

Actions biochimiques/physiologiques

Transient receptor potential cation channel, subfamily M, member 3 (TRPM3) belongs to the TRP family of channels. These cation-selective channels that regulate homeostasis, calcium signaling, calcium entry and storage.

Séquence

Synthetic peptide located within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

J Oberwinkler et al.
Handbook of experimental pharmacology, (179)(179), 253-267 (2007-01-16)
TRPM3 is the last identified member of the TRPM subfamily and is most closely related to TRPM1. Due to alternative splicing, the TRPM3 gene encodes a large number of different variants. One splice event, affecting the pore-forming region of the

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique