Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Documents

AV32869

Sigma-Aldrich

Anti-ARID3A antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-AT rich interactive domain 3A (BRIGHT-like)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

63 kDa

Espèces réactives

rat, human, dog, pig, bovine, mouse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_005215

Numéro d'accès UniProt

Q99856

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ARID3A(1820)

Description générale

ARID3A is a transcription factor that is involved in somatic cell reprograming. This transcription factor has also been implicated in chromatin assembly and developmental plasticity.
Rabbit Anti-ARID3A antibody recognizes bovine, human, mouse, rat, and canine ARID3A.

Immunogène

Synthetic peptide directed towards the middle region of human ARID3A

Application

Rabbit Anti-ARID3A antibody can be used for western blot assays at 0.25μg/ml.

Actions biochimiques/physiologiques

ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.

Séquence

Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Melissa Popowski et al.
Stem cell reports, 2(1), 26-35 (2014-02-11)
We show here that singular loss of the Bright/Arid3A transcription factor leads to reprograming of mouse embryonic fibroblasts (MEFs) and enhancement of standard four-factor (4F) reprogramming. Bright-deficient MEFs bypass senescence and, under standard embryonic stem cell (ESC) culture conditions, spontaneously
Danjuan Lin et al.
Molecular cancer, 6, 23-23 (2007-03-28)
Bright/ARID3A is a nuclear matrix-associated transcription factor that stimulates immunoglobulin heavy chain (IgH) expression and Cyclin E1/E2F-dependent cell cycle progression. Bright positively activates IgH transcriptional initiation by binding to ATC-rich P sites within nuclear matrix attachment regions (MARs) flanking the
Guangyu An et al.
Stem cells (Dayton, Ohio), 28(9), 1560-1567 (2010-08-04)
B-cell regulator of immunoglobulin heavy chain transcription (Bright)/ARID3a, an A+T-rich interaction domain protein, was originally discovered in B lymphocyte lineage cells. However, expression patterns and high lethality levels in knockout mice suggested that it had additional functions. Three independent lines

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique