Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Documents

AV32027

Sigma-Aldrich

Anti-MTF1 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Metal-regulatory transcription factor 1

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

81 kDa

Espèces réactives

rat, human, dog, mouse, bovine, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_005946

Numéro d'accès UniProt

Q14872

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MTF1(4520)

Catégories apparentées

Description générale

Metal-response element-binding transcription factor 1 (MTF1) is a cellular zinc sensor that is involved in zinc homeostasis. MTF1 is also known to protect against oxidative stress and metal toxicity. Furthermore, MTF1 can modulate metallothionein gene expression.
Rabbit Anti-MTF1 antibody recognizes human, mouse, rat, bovine, and canine MTF1.

Immunogène

Synthetic peptide directed towards the C terminal region of human MTF1

Application

Rabbit Anti-MTF1 antibody can be used for western blot applications at a concentration of 5.0μg/ml.

Actions biochimiques/physiologiques

The zinc finger transcription factor MTF-1 (metal-responsive transcription factor-1) is conserved from insects to vertebrates. The major role of MTF-1 in both organisms is to control the transcription of genes involved in the homeostasis and detoxification of heavy metal ions such as Cu2+, Zn2+ and Cd2+. In mammals, MTF-1 serves at least two additional roles. First, targeted disruption of the MTF-1 gene results in death at embryonic day 14 due to liver degeneration, revealing a stage-specific developmental role. Second, under hypoxic-anoxic stress, MTF-1 helps to activate the transcription of the gene placental growth factor (PIGF), an angiogenic protein.

Séquence

Synthetic peptide located within the following region: QSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

G K Andrews
Biometals : an international journal on the role of metal ions in biology, biochemistry, and medicine, 14(3-4), 223-237 (2002-02-08)
Zinc metabolism in higher eukaryotes is complex, being controlled by uptake, efflux, and storage in individual cells, as well as in peripheral tissues and organs. Recently there have been advances in the understanding of the genes involved in these processes
R Heuchel et al.
The EMBO journal, 13(12), 2870-2875 (1994-06-15)
We have described and cloned previously a factor (MTF-1) that binds specifically to heavy metal-responsive DNA sequence elements in the enhancer/promoter region of metallothionein genes. MTF-1 is a protein of 72.5 kDa that contains six zinc fingers and multiple domains

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique