APREST80650

PrEST Antigen MED19

Prestige Antigens^™ Powered by Atlas Antibodies, buffered aqueous solution

• Synonyme(s) : LCMR1
• Code UNSPSC : 12352202

Propriétés

• Produit recombinant: expressed in E. coli
• Pureté: >80% (SDS-PAGE)
• Forme: buffered aqueous solution
• Poids mol.: predicted mol wt 25 kDa
• Produit purifié par: immobilized metal affinity chromatography (IMAC)
• Concentration: ≥0.5 mg/mL
• Séquence immunogène: PPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPG
• Numéro d'accès Ensembl | humain: ENSG00000156603
• Numéro d'accès UniProt: A0JLT2
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Informations sur le gène: human ... MED19(219541)

Description

Description générale

Recombinant protein fragment of Human MED19 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Application

Suitable as a blocking agent using corresponding antibodies.

Liaison

Corresponding Antibody HPA040860.

Forme physique

Solution in 1 M urea-PBS, pH 7.4

Notes préparatoires

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Informations légales

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable