WH0344387M1

Monoclonal Anti-CDKL4 antibody produced in mouse

clone 5G3, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-cyclin-dependent kinase-like 4
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 5G3, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: NM_001009565
• UniProt accession no.: Q5MAI5
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CDKL4(344387)

Description

General description

Cyclin dependent kinase-like 4 (CDKL4) is part of the cyclin-dependent protein kinase (CDK) family.

Immunogen

CDKL4 (AAV63975, 196 a.a. ~ 295 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGISIPEPEDMETLEEKFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIK

Biochem/physiol Actions

Cyclin dependent kinase-like 4 (CDKL4) has been associated with colorectal cancer.

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves