SAB1409088

Monoclonal Anti-ANKRD17 antibody produced in mouse

clone 1D8, ascites fluid, solution

• Synonym(s): FLJ22206, GTAR, KIAA0697, NY-BR-16
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 1D8, monoclonal
• form: solution
• mol wt: antigen 37.07 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG1κ
• NCBI accession no.: NM_032217
• UniProt accession no.: O75179
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ANKRD17(26057)

Description

General description

This gene encodes a protein with ankyrin repeats, which are associated with protein-protein interactions. Studies in mice suggest that this protein is involved in liver development. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

Immunogen

ANKRD17 (NP_115593, 2501 a.a. ~ 2603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPDGAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSVHMNQLG

Physical form

Clear solution

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable