SAB1405297

Monoclonal Anti-MFRP, (C-terminal) antibody produced in mouse

clone 3H5, purified immunoglobulin, buffered aqueous solution

• Synonym(s): C1QTNF5, FLJ30570, NNO2, rd6
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3H5, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2bλ
• NCBI accession no.: NM_031433
• UniProt accession no.: Q9BY79
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MFRP(83552)

Description

General description

This gene encodes a member of the frizzled-related proteins. The encoded protein may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen. The protein is encoded by a bicistronic mRNA, which also encodes C1q and tumor necrosis factor related protein 5

Immunogen

MFRP (NP_113621, 480 a.a. ~ 579 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NTTAFPNIWVGMITQEEVVEVLSGYKSLTSLPCYQHFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAEHQCQSGLALLGTPWPFNCNRLPEAADLEACAQP

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable