SAB1404948

Monoclonal Anti-RAB21, (C-terminal) antibody produced in mouse

clone 1G4, purified immunoglobulin, buffered aqueous solution

• Synonym(s): KIAA0118
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1G4, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~38.21 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• NCBI accession no.: NM_014999
• UniProt accession no.: Q9UL25
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RAB21(23011)

Description

General description

RAB21 belongs to the RAB family of small GTP-binding proteins that regulate intracellular vesicle targeting (Opdam et al., 2000 [PubMed 10887961]).[supplied by OMIM

Immunogen

RAB21 (NP_055814, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQPGTARRGVQIIDDEPQAQTSGGGCCSSG

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable