Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

MSQC2

Sigma-Aldrich

MS QCAL Peptide Mix

lyophilized powder

Synonym(s):

MS Qual/Quant QC Mix, universal MS platform standard

Sign Into View Organizational & Contract Pricing

Select a Size

2 X 25 μG
$321.00

$321.00


Please contact Customer Service for Availability

Request a Bulk Order

Select a Size

Change View
2 X 25 μG
$321.00

About This Item

UNSPSC Code:
12352200
NACRES:
NA.24

$321.00


Please contact Customer Service for Availability

Request a Bulk Order

form

lyophilized powder

analyte chemical class(es)

amino acids, peptides, proteins

technique(s)

HPLC: suitable

application(s)

food and beverages

format

multi-component solution

shipped in

ambient

storage temp.

2-8°C

Looking for similar products? Visit Product Comparison Guide

General description

QCAL was designed using the QconCAT technology and recombinantly expressed in E. coli.  The parent protein sequence of QCAL is as follows:

MGALRVFDEFKPLVEEPQNLIRVFDEFKPLVKPEEPQNLIRVFDEFKPLVKPEEKPQNLIRVFDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIRVFKPDEFKPLVKPEEKPQNKPLIKPRVFDEFQPLVEEPQNLIRGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGGGVNDNEEGFFSARGVNDNEEGFFSAKGGGVNDNEEGFFSARAVMDDFAAFVEKAVMMDDFAAFVEKAVMMMDDFAAFVEKGLVKFVVPRALELFRIGDYAGIKEALDFFARYLGYLEQLLRVLYPNDNFFEGKLFTFHADICTLPDTEKALVALVLVPRGSLEVLFQGPIEGRTENLYFQGDDDDKALVALVHHHHHH

QCAL was subsequently digested with trypsin to give a core mixture of 22 peptides.

Application

MSQC2 is intended to act as a universal MS platform standard, by providing several elements for calibration and performance assessment, such as instrument resolution and linearity of signal detection.
This product is optimized to assess platform characteristics, including:
  • Repeatability/Reproducibility between runs
  • System stability (drift, chromatography, signal intensity, sensitivity, etc.)
  • Inter- and intra- platform and lab comparisons

Features and Benefits

General

Complexity
  • Defined mixture gives confidence in your instruments analysis

Components

Each vial contains 25 μg of lyophilized peptides that are derived from trypsin digestion of the protein concatamer QCAL.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Claire E Eyers et al.
Journal of the American Society for Mass Spectrometry, 19(9), 1275-1280 (2008-07-05)
If proteome datasets are to be collated, shared, and merged for higher level proteome analyses, there is a need for generally accepted strategies and reagents for optimization and standardization of instrument performance. At present, there is no single protein or
Julie M Pratt et al.
Nature protocols, 1(2), 1029-1043 (2007-04-05)
An important area of proteomics involves the need for quantification, whether relative or absolute. Many methods now exist for relative quantification, but to support biomarker proteomics and systems biology, absolute quantification rather than relative quantification is required. Absolute quantification usually

Questions

  1. 1. I would like to clarify whether this peptide quantity is based on the mass of the E.coli protein before trypsinization. 2. Is this product LC-MS injection-ready? 3. Please provide the protocol for this product.

    1 answer
    1. This product is a mixture of 22 peptides derived from the post-trypsin digest of QCAL. This is a lyophilized powder. Upon reconstitution with an appropriate solvent - typically 0.1% formic or trifluoroacetic acid in water - the solution is injection-ready. Please see the link below to review the product technical bulletin for further instructions for use:
      https://www.sigmaaldrich.com/deepweb/assets/sigmaaldrich/product/documents/827/937/msqc2dat.pdf

      Helpful?

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service