Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

HPA020103

Sigma-Aldrich

Anti-MACC1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

Synonym(s):

Anti-SH3 domain-containing protein 7a5

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

FRSGRIAQSMSEANLIDMEAGKLSKSCNITECQDPDLLHNWPDAFTLRGNNASKVANPFWNQLSASNPF

UniProt accession no.

application(s)

research pathology

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MACC1(346389)

General description

Metastasis associated in colon cancer 1 (MACC1) is an 852 amino acid protein with a Src-homology 3 (SH3)-domain and a motif which is rich in proline. The gene encoding it has been studied as an oncogene in a wide variety of carcinomas like that of the lung and liver. It is localized on human chromosome 7.

Immunogen

SH3 domain-containing protein 7a5 recombinant protein epitope signature tag (PrEST)

Application

Anti-MACC1 antibody produced in rabbit has been used in immunohistochemistry and immunoblotting.
Anti-MACC1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Metastasis associated in colon cancer 1 (MACC1) functions as a regulator in the mitogen-activated protein kinase (MAPK) pathways in breast carcinoma. It is also involved in the pathways mediated by hepatocyte growth factor (HGF). MACC1 is associated with metastasis of colon cancer and it is useful as a biomarker for progression of many cancers, like gastric cancer.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75105

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ga-Eon Kim et al.
Analytical and quantitative cytopathology and histopathology, 37(2), 96-104 (2015-06-13)
To investigate whether metastasis associated in colon cancer 1 (MACC1) expression is a prognostic marker in breast cancer and to demonstrate the potential correlation between MACC1 and mitogen-activated protein kinase (MAPK) expression. Immunohistochemical staining with anti-MACC1 and phospho-p44/42 MAPK antibodies
MACC1 is post-transcriptionally regulated by miR-218 in colorectal cancer
Ilm K, et al.
Oncotarget, 7(33), 53443-53443 (2016)
Hassan Ashktorab et al.
Journal of translational medicine, 14(1), 215-215 (2016-07-22)
Colorectal cancer is a preventable disease if caught at early stages. This disease is highly aggressive and has a higher incidence in African Americans. Several biomarkers and mutations of aggressive tumor behavior have been defined such as metastasis-associated in colon
MACC1 regulates Fas mediated apoptosis through STAT1/3--Mcl-1 signaling in solid cancers
Radhakrishnan H, et al.
Cancer Letters, 403(33), 231-245 (2017)
Lijian Chen et al.
Journal of cancer research and therapeutics, 10(4), 1052-1056 (2015-01-13)
The clinical significance of metastasis associated in colon cancer 1 (MACC1), in human gallbladder cancer, is not yet established. This study was performed to assess the expression of MACC1 in benign and malignant gallbladder lesions, and to assess its clinicopathological

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service