Skip to Content
MilliporeSigma
All Photos(7)

Key Documents

HPA019654

Sigma-Aldrich

Anti-CNTF antibody produced in rabbit

affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym(s):

CNTF Antibody - Anti-CNTF antibody produced in rabbit, Cntf Antibody, Anti-CNTF, Anti-Ciliary neurotrophic factor, Anti-ZFP91 antibody produced in rabbit

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

FHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CNTF(1270)

General description

CNTF (Ciliary neurotrophic factor) is a neural cytokine belonging to the hematopoietic cytokine subfamily. It is predominantly expressed in the anterior nuclei of the thalamus.

Immunogen

Ciliary neurotrophic factor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

CNTF (Ciliary neurotrophic factor) is crucial for the survival of ciliary ganglion neurons. The signaling cascade initiated by CNTF is mediated by heteromeric receptor complex composed of CNTF receptor α, leukemia inhibitory factor receptor β and glycoprotein gp130. The binding of CNTF to the receptor complex results in the activation of pathways involving Jak and STAT family of DNA-binding transcription factors. The effective therapeutic use of CTNF has been studied in retinitis pigmentosa, Parkinson′s disease, Huntington′s disease and other neurodegenerative disorders.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74514

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

N Y Ip et al.
Annual review of neuroscience, 19, 491-515 (1996-01-01)
Because the actions of neurotrophic factors appear distinct from those of traditional growth factors and cytokines, it was long assumed that the neurotrophic factors utilized receptors and signaling systems fundamentally different from those used by growth factors operating elsewhere in
N Stahl et al.
Journal of neurobiology, 25(11), 1454-1466 (1994-11-01)
Recent efforts to understand the mechanism of action of CNTF have led to the identification of a three-component receptor complex for CNTF. The distributions of these receptor components explain the known target cell specificity of CNTF, and have also helped
A central role for ciliary neurotrophic factor?
D C Lo
Proceedings of the National Academy of Sciences of the United States of America, 90(7), 2557-2558 (1993-04-01)
Paul A Sieving et al.
Proceedings of the National Academy of Sciences of the United States of America, 103(10), 3896-3901 (2006-03-01)
Neurotrophic factors are agents with a promising ability to retard progression of neurodegenerative diseases and are effective in slowing photoreceptor degeneration in animal models of retinitis pigmentosa. Here we report a human clinical trial of a neurotrophic factor for retinal
CNTF: a putative link between dopamine D2 receptors and neurogenesis.
Mayra Mori et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 28(23), 5867-5869 (2008-06-06)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service