HPA017292

Anti-B3GNT5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-BGnT-5, Anti-Beta-1,3-N- acetylglucosaminyltransferase-5, Anti-Beta3Gn-T5, Anti-Cer synthase, Anti-Lactotriaosylceramide synthase, Anti-Lc(3, Anti-Lc3 synthase, Anti-UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA017292
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50
• immunogen sequence: GAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLYIDDVFMGLCANKIGIVPQDHVFFSGEGKTPYHPCIYEKMMTSHGHLEDLQDLWKNATDPKV
• UniProt accession no.: Q9BYG0
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... B3GNT5(84002)

Description

General description

B3GNT5 (UDP-GlcNAc: β Gal β-1,3-N-acetylglucosaminyltransferase 5) is a type II membrane protein belonging to the β3Gn-T family (β3Gn-T5). Its three motif sturcture consists of a NH2-terminal cytoplasmic domain, a transmembrane region, and a stem region and catalytic domain. It is highly expressed in the lung, colon, placenta, testis, pituitary gland. In addition, it is also expressed at low level in cerebellum.

Immunogen

UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

B3GNT5 (UDP-GlcNAc: β Gal β-1,3-N-acetylglucosaminyltransferase 5) plays a key role in the biosynthesis of Lewis antigens. It is mainly responsible for the synthesis of short polylactosamine chains or initiation of polylactosamine synthesis. It has been reported that overexpressed B3GNT5 in human gastric carcinoma cell lines alters sialyl-Lewis x expression and Helicobacter pylori adhesion.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72266

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves