Skip to Content
MilliporeSigma
All Photos(6)

Key Documents

HPA004938

Sigma-Aldrich

Anti-PTGDS antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Beta-trace protein, Anti-Cerebrin-28, Anti-Glutathione-independent PGD synthetase, Anti-Lipocalin-type prostaglandin-D synthase, Anti-PGD2 synthase, Anti-PGDS, Anti-PGDS antibody produced in rabbit, Anti-PGDS2, Anti-PTGDS, Anti-Prostaglandin-D2 synthase, Anti-Prostaglandin-H2 D-isomerase precursor

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$757.00

$757.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
$757.00

About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

$757.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

SWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYSRTQT

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PTGDS(5730)

General description

Lipocalin-type prostaglandin D2 (PGD2) synthase (PTGDS) is responsible for the synthesis of prostaglandin D2 (PGD2). PTGDS belongs to the lipocalin ligand-carrier protein family. PTGDS is also called glutathione (GSH)- independent PGDS and is a brain type PGDS, which is found in rat brain, spinal cord, epididymis, cochlea, retina and is also found in extracellular space. In humans, PTGDS gene is located on the HSA9q34 loci of chromosome.

Immunogen

Prostaglandin-H2 D-isomerase precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

PTGDS is an important enzyme in the arachidonic pathway where it converts prostaglandin H2 (PGH2) to PGD2. PTGDS also functions as a transporter, and it has been suggested that it transports ligands such as retinoic acid, gangliosides, bile pigments and amyloid β peptides. PTGDS is also responsible for the development of male reproducitve organs and the regulation of sleep, pain sensation and allergy. Mice with unilateral cryptorchidism with second phase of testicular decent are found to be homozygous or heterozygous PTGDS deficient. Expression of PTGDS is also found to vary between manic and depressive states in patients with rapid cycling bipolar disorder. It is also expressed differentially between attention deficit hyperactivity disorder (ADHD) patients and bipolar disorder patients. PTGDS is less expressed in patients with bipolar disorder than in ADHD patients.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST70110

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Comparative mapping of lipocalin genes in human and mouse: the four genes for complement C8 gamma chain, prostaglandin-D-synthase, oncogene-24p3, and progestagen-associated endometrial protein map to HSA9 and MMU2.
Chan P
Genomics, 23(1), 145-150 (1994)
Reduced mRNA expression of PTGDS in peripheral blood mononuclear cells of rapid-cycling bipolar disorder patients compared with healthy control subjects.
Munkholm K
The International Journal of Neuropsychopharmacology, 18(5), pyu101-pyu101 (2014)
Prostaglandin D2 induces nuclear import of the sex-determining factor SOX9 via its cAMP-PKA phosphorylation.
Malki S
The Embo Journal, 24(10), 1798-1809 (2005)
Jean-Charles Nault et al.
Gastroenterology, 152(4), 880-894 (2016-12-13)
Hepatocellular adenomas (HCAs) are benign liver tumors that can be assigned to molecular subtypes based on inactivating mutations in hepatocyte nuclear factor 1A, activating mutations in β-catenin, or activation of inflammatory signaling pathways. We aimed to update the classification system
Margaux Sala et al.
Hepatology communications, 4(6), 809-824 (2020-06-04)
Until recently, 10% of hepatocellular adenomas (HCAs) remained unclassified (UHCA). Among the UHCAs, the sonic hedgehog HCA (shHCA) was defined by focal deletions that fuse the promoter of Inhibin beta E chain with GLI1. Prostaglandin D2 synthase was proposed as

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service