Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV54313

Sigma-Aldrich

Anti-AMT antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Aminomethyltransferase, Anti-GCE, Anti-GCST, Anti-NKH

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
$725.00

$725.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
$725.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

$725.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

44 kDa

species reactivity

bovine, dog, rabbit, human, rat, horse, guinea pig, mouse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... AMT(275)

Immunogen

Synthetic peptide directed towards the N terminal region of human AMT

Application

Anti-AMT antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

AMT gene encodes an enzyme aminomethyltransferase (T-protein), localized on to subband 3p21.2-p21.1, that is the critical component of the glycine cleavage system. T-protein facilitates the degradation of glycine to produce ammonia and 5,10-methylenetetrahydrofolate. Mutation in the AMT gene leads to typical or atypical nonketotic hyperglycinemia (NKH).

Sequence

Synthetic peptide located within the following region: QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Kazuko Okamura-Ikeda et al.
The Journal of biological chemistry, 285(24), 18684-18692 (2010-04-09)
Aminomethyltransferase, a component of the glycine cleavage system termed T-protein, reversibly catalyzes the degradation of the aminomethyl moiety of glycine attached to the lipoate cofactor of H-protein, resulting in the production of ammonia, 5,10-methylenetetrahydrofolate, and dihydrolipoate-bearing H-protein in the presence
K Nanao et al.
Human genetics, 93(6), 655-658 (1994-06-01)
We have investigated the molecular lesions of T-protein deficiency causing typical or atypical nonketotic hyperglycinemia (NKH) in two unrelated pedigrees. A patient with typical NKH was identified as being homozygous for a missense mutation in the T-protein gene, a G-to-A
K Nanao et al.
Genomics, 19(1), 27-30 (1994-01-01)
The gene for human aminomethyltransferase (AMT), also known as the T-protein of the glycine cleavage system, was isolated from a human placental cosmid library and examined by restriction mapping, polymerase chain reaction analysis, and DNA sequencing. The gene is about

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service