AV50803
Anti-ZNF385B antibody produced in rabbit
affinity isolated antibody
Synonym(s):
Anti-FLJ25270, Anti-ZNF533, Anti-Zinc finger protein 385B
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
UNSPSC Code:
12352203
NACRES:
NA.41
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
form
buffered aqueous solution
mol wt
41 kDa
species reactivity
guinea pig, rabbit, mouse, bovine, horse, human, rat, dog
concentration
0.5 mg - 1 mg/mL
technique(s)
western blot: suitable
NCBI accession no.
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... ZNF385B(151126)
General description
The gene ZNF385B (Zinc finger protein 385B) is mapped to human chromosome 2q31.2-q31.3. It contains 4 matrin-type zinc fingers. It is present in the germinal center of lymph nodes. ZNF385B is expressed in spleen, lymph node and tonsil.
Immunogen
Synthetic peptide directed towards the C terminal region of human ZNF385B
Application
Anti-ZNF385B antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Zinc finger protein 385B (ZNF385B; ZNF533) is a transcription factor. ZNF385B modulates transactivation of p53 and is involved in B-cell apoptosis. The expression of ZNF385B correlates with survival in ovarian carcinomas. Single nucleotide polymorphism in ZNF385B is associated with autism. Similarly, polymorphism in ZNF385B is also linked to nonsyndromic orofacial clefts (NSOC).
Sequence
Synthetic peptide located within the following region: HVNSEIQLKQHISSRRHKDRVAGKPLKPKYSPYNKLQRSPSILAAKLAFQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Shuang Liang et al.
Journal of Zhejiang University. Science. B, 15(3), 264-271 (2014-03-07)
A study in a Caucasian population has identified two single-nucleotide polymorphisms (SNPs) in ZNF533, one in DOCK4, and two in IMMP2L, which were all significantly associated with autism. They are located in AUTS1 and AUTS5, which have been identified as
Bente Vilming Elgaaen et al.
PloS one, 7(9), e46317-e46317 (2012-10-03)
The oncogenesis of ovarian cancer is poorly understood. The aim of this study was to identify mRNAs differentially expressed between moderately and poorly differentiated (MD/PD) serous ovarian carcinomas (SC), serous ovarian borderline tumours (SBOT) and superficial scrapings from normal ovaries
Jun Wu et al.
DNA and cell biology, 30(1), 47-54 (2010-09-21)
The etiology of nonsyndromic orofacial clefts (NSOC) has been considered "complex" or "multifactorial." Etiologic heterogeneity induces disparities in the results among different populations. The zinc finger protein 533 (ZNF533) and several environmental factors have been revealed to be associated with
ZNF385B is characteristically expressed in germinal center B cells and involved in B-cell apoptosis.
Kazutoshi Iijima et al.
European journal of immunology, 42(12), 3405-3415 (2012-09-05)
We previously identified zinc finger (ZF) protein ZNF385B as a molecule specifically expressed in Burkitt's lymphoma (BL) among hematologic malignancies. Here, we investigated ZNF385B expression in healthy B cells in a variety of hematological tissues by RT-PCR and immunohistochemistry. ZNF385B
J H Laity et al.
Current opinion in structural biology, 11(1), 39-46 (2001-02-17)
Zinc finger proteins are among the most abundant proteins in eukaryotic genomes. Their functions are extraordinarily diverse and include DNA recognition, RNA packaging, transcriptional activation, regulation of apoptosis, protein folding and assembly, and lipid binding. Zinc finger structures are as
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service