AV42287

Anti-FST antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-FS, Anti-Follistatin
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 35 kDa
• species reactivity: sheep, goat, rat, dog, mouse, human, horse, rabbit, guinea pig, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_006341
• UniProt accession no.: Q6FHE1
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FST(10468)

Description

General description

Follistatin is an autocrine glycoprotein component of the inhibin-activin-follistatin axis that mediates many cellular processes via its ability to bind and neutralize members of the TGF-β superfamily such as activin and myostatin/GDF-8.

Specificity

Anti-FST polyclonal antibody reacts with canine, chicken, bovine, pig, human, mouse, rat, and zebrafish follistatin proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human FST

Application

Anti-FST polyclonal antibody is used to tag follistatin protein for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of follistatin in the regulation of TGF-β superfamily mediated processes such as those regulated by myostatin/GDF8 and activin.

Biochem/physiol Actions

Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release.Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.

Sequence

Synthetic peptide located within the following region: SLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable