AV34382

Anti-NFKBIB antibody produced in rabbit

affinity isolated antibody

• Synonym(s): Anti-Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, β
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 38 kDa
• species reactivity: rabbit, mouse, human, rat, guinea pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_002494
• UniProt accession no.: Q15653
• shipped in: wet ice
• storage temp.: −20°C
• Gene Information: human ... NFKBIB(4793)

Description

General description

NFKBIB is a NF-κB inhibitor that forms a complex with NF-κB and traps it in the cytoplasm. Serine phosphorylation in NFKBIB proteins activates its ubiquitin-mediated degradation. This subsequently facilitates the nuclear transport and functions of NF-κB proteins.
Rabbit Anti-NFKBIB antibody recognizes human, mouse, rat, canine, and bovine NFKBIB.

Immunogen

Synthetic peptide directed towards the N terminal region of human NFKBIB

Application

Rabbit Anti-NFKBIB antibody can be used for western blot applications at a concentration of 0.5 μg/ml.

Biochem/physiol Actions

NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM].

Sequence

Synthetic peptide located within the following region: LVFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTAL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable