Skip to Content
Merck
All Photos(5)

Key Documents

SAB1402127

Sigma-Aldrich

Monoclonal Anti-BDNF antibody produced in mouse

clone 1B10, purified immunoglobulin, buffered aqueous solution

Synonym(s):

MGC34632

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.43

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1B10, monoclonal

form

buffered aqueous solution

mol wt

antigen ~53.28 kDa

species reactivity

human

technique(s)

immunofluorescence: suitable
immunoprecipitation (IP): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BDNF(627)

General description

The brain derived neurotrophic factor (BDNF) gene is mapped to human chromosome 11p14.1.
The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer′s and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. (provided by RefSeq)

Immunogen

BDNF (AAH29795, 1 a.a. ~ 247 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHMIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYKTKCNPMGYAKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Application

Monoclonal Anti-BDNF antibody produced in mouse has been used in western blotting.

Biochem/physiol Actions

Brain derived neurotrophic factor (BDNF) is involved in hippocampal function and verbal episodic memory in humans. Variation in the BDNF gene expression alters these neurological functions. BDNF also plays a vital role in vascular function and participates in angiogenesis via the specific receptor tropomyosin-related kinase B (TrkB). ProBDNF interacts with the p75 neurotrophin receptor, leading to long-term depression in the hippocampus.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Mohammad Torabi-Nami et al.
EXCLI journal, 12, 347-372 (2013-01-01)
Experimentally-induced total sleep deprivation (TSD) and chronic partial sleep restriction (CPSR) leads to the emergence of cognitive impairments. This is hypothesized to result from a consequent neuroinflammation which may also hasten the neurodegenerative processes. Neuroinflammatory markers such as tumor necrosis
Peripheral vascular reactivity and serum BDNF responses to aerobic training are impaired by the BDNF Val66Met polymorphism.
Lemos JR Jr, et al.
Physiological Genomics, 48(2), 116-123 (2015)
The BDNF val66met polymorphism affects activity-dependent secretion of BDNF and human memory and hippocampal function.
Egan MF, et al.
Cell, 112(2), 257-269 (2003)
11p14. 1 microdeletions associated with ADHD, autism, developmental delay, and obesity.
Shinawi M, et al.
American Journal of Medical Genetics. Part A, 155(6), 1272-1280 (2011)
Electroacupuncture at the Baihui acupoint alleviates cognitive impairment and exerts neuroprotective effects by modulating the expression and processing of brain-derived neurotrophic factor in APP/PS1 transgenic mice.
Lin R
Molecular Medicine Reports, 13(2), 1611-1617 (2016)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service