DNA polymerase δ 4 (POLD4), also known as p12, is the smallest subunit of DNA polymerase (Pol) δ. It is encoded by the gene mapped to human chromosome 11q13.2.
The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).
Immunogen
POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Biochem/physiol Actions
DNA polymerase (Pol) δ plays a vital role in DNA replication, DNA repair processes and genetic recombination. POLD4 stabilizes the Pol δ holoenzyme. In addition, it also facilitates pol δ-PCNA complex stabilization. Proteolysis of POLD4 in response to DNA damage leads to the consequent conversion of the holoenzyme pol δ4 to the heterotrimer pol δ3. Pol δ3 acts as an antimutator polymerase and is supposed to enhance surveillance against mutagenesis. Downregulated expression of the gene is associated with the genomic instability in lung cancer.
Physical form
Solution
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Human DNA polymerase delta (Polδ), a holoenzyme consisting of p125, p50, p68, and p12 subunits, plays an essential role in DNA replication, repair, and recombination. Herein, using multiple physicochemical and cellular approaches, we found that the p12 protein forms a
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
