WH0003211M1

Monoclonal Anti-HOXB1 antibody produced in mouse

clone 3D1, purified immunoglobulin, buffered aqueous solution

• Synonym(s): Anti-HOX2, Anti-HOX2I, Anti-Hox2.9, Anti-MGC116843, Anti-MGC116844, Anti-MGC116845, Anti-homeobox B1
• MDL number: MFCD02263085
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 3D1, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: NM_002144
• UniProt accession no.: P14653
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... HOXB1(3211)

Description

General description

This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXB genes located in a cluster on chromosome 17. (provided by RefSeq)

Immunogen

HOXB1 (NP_002135, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDYNRMNSFLEYPLCNRGPSAYSAHSAPTSFPPSSAQAVDSYASEGRYGGGLSSPAFQQNSGYPAQQPPSTLGV

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class Code: 10 - Combustible liquids
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves