Skip to Content
Merck
All Photos(2)

Documents

SAB1411910

Sigma-Aldrich

ANTI-PPARGC1A antibody produced in mouse

clone 3B5, purified immunoglobulin, buffered aqueous solution

Synonym(s):

LEM6, PGC-1(alpha), PGC-1v, PGC1, PPARGC1A

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3B5, monoclonal

form

buffered aqueous solution

mol wt

antigen 37.84 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

General description

PPARG (peroxisome proliferator activated receptor gamma) coactivator 1 α (PPARGC1A) is a 91kDa multifunctional regulatory factor, encoded by the gene mapped to human chromosome 4p15.1. The encoded protein is mainly expressed in heart, skeletal muscle and kidney.
The protein encoded by this gene is a transcriptional coactivator that regulates the genes involved in energy metabolism. This protein interacts with PPARgamma, which permits the interaction of this protein with multiple transcription factors. This protein can interact with, and regulate the activities of, cAMP response element binding protein (CREB) and nuclear respiratory factors (NRFs). It provides a direct link between external physiological stimuli and the regulation of mitochondrial biogenesis, and is a major factor that regulates muscle fiber type determination. This protein may be also involved in controlling blood pressure, regulating cellular cholesterol homoeostasis, and the development of obesity. (provided by RefSeq)

Immunogen

PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR

Biochem/physiol Actions

PPARG coactivator 1 α (PPARGC1A) interacts with a wide range of transcription factors and plays a vital role in cellular energy metabolism. The encoded protein regulates activity of many transcription factors and functions as a molecular switch for various cellular processes, such as mitochondrial biogenesis and respiration, gluconeogenesis and glucose transport, glycogenolysis, fatty acid oxidation, peroxisomal remodeling, muscle fiber-type switching and oxidative phosphorylation. Additionally, it is also acts as a regulator of Type 2 diabetes mellitus (T2DM) and is considered to be a potential target for anti-diabetic therapy. The protein functions as a tumor suppressor in hepatocellular carcinoma and can be used as a promising therapeutic target for the same. It is downregulated in prostate cancer. Presence of PPARGC1A inhibits prostate cancer progression and metastasis. However, presence of this protein gives selective advantages in breast cancer and melanoma cells.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Chi Luo et al.
Nature, 537(7620), 422-426 (2016-09-01)
Melanoma is the deadliest form of commonly encountered skin cancer because of its rapid progression towards metastasis. Although metabolic reprogramming is tightly associated with tumour progression, the effect of metabolic regulatory circuits on metastatic processes is poorly understood. PGC1α is
Haijiang Wu et al.
The Journal of endocrinology, 229(3), R99-R115 (2016-04-21)
Type 2 diabetes mellitus (T2DM) is a chronic disease characterized by glucose metabolic disturbance. A number of transcription factors and coactivators are involved in this process. Peroxisome proliferator-activated receptor gamma coactivator 1 alpha (PGC-1α) is an important transcription coactivator regulating
Rui Liu et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 39(4), 1010428317695031-1010428317695031 (2017-04-07)
Peroxisome proliferator-activated receptor gamma coactivator-1 alpha plays a crucial role in regulating the biosynthesis of mitochondria, which is closely linked to the energy metabolism in various tumors. This study investigated the regulatory role of peroxisome proliferator-activated receptor gamma coactivator-1 alpha
Veronica Torrano et al.
Nature cell biology, 18(6), 645-656 (2016-05-24)
Cellular transformation and cancer progression is accompanied by changes in the metabolic landscape. Master co-regulators of metabolism orchestrate the modulation of multiple metabolic pathways through transcriptional programs, and hence constitute a probabilistically parsimonious mechanism for general metabolic rewiring. Here we

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service