Skip to Content
Merck
All Photos(5)

Key Documents

SAB1402390

Sigma-Aldrich

Monoclonal Anti-VEGF antibody produced in mouse

clone 3F7, purified immunoglobulin, buffered aqueous solution

Synonym(s):

MGC70609, VEGF, VEGF-A, VPF

Sign Into View Organizational & Contract Pricing

Select a Size

100 μG
R$4,333.00

R$4,333.00


Check Cart for Availability


Select a Size

Change View
100 μG
R$4,333.00

About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

R$4,333.00


Check Cart for Availability

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

3F7, monoclonal

form

buffered aqueous solution

mol wt

antigen ~37.55 kDa

species reactivity

human

technique(s)

capture ELISA: suitable
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: suitable

isotype

IgG2aκ

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... VEGFA(7422)

General description

The vascular endothelial growth factor (VEGF) gene is localized on human chromosome 6p21.3 and is thought to encode four different isoforms. It signals through the three receptors, that is, fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product. The protein is expressed in vascularized tissues.
This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. (provided by RefSeq)

Immunogen

VEGF (NP_003367, 27 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCEC

Application

Monoclonal Anti-VEGF antibody produced in mouse has been used in Western Blotting.

Biochem/physiol Actions

Vascular endothelial growth factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates the proliferation and survival of endothelial cells. It promotes angiogenesis and vascular permeability. VEGF is involved in the induction of tumor metastasis and intraocular neovascular syndromes.Polymorphism in the gene encoding it is linked with diabetic retinopathy in type 2 diabetes.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Libin Ma et al.
International journal of molecular medicine, 46(1), 265-279 (2020-07-07)
The aim of the present study was to explore the mechanism by which Notch1‑small activating (sa)RNA restored androgen sensitivity in human metastatic castration‑resistant prostate cancer (CRPC). After transfection of Notch1‑saRNA‑1480 in PC3 cells, the expression of Notch1 and androgen receptor (AR) was
Yue Zhao et al.
Scientific reports, 6, 28627-28627 (2016-06-25)
The interaction between endothelial cells (ECs) and smooth muscle cells (SMCs) plays a critical role in the maintenance of vessel wall homeostasis. The X-box binding protein 1 (XBP1) plays an important role in EC and SMC cellular functions. However, whether
Suppression of retinal neovascularization in vivo by inhibition of vascular endothelial growth factor (VEGF) using soluble VEGF-receptor chimeric proteins
Aiello LP
Proceedings of the National Academy of Sciences of the USA (1995)
A common polymorphism in the 5'-untranslated region of the VEGF gene is associated with diabetic retinopathy in type 2 diabetes
Awata T
Diabetes (2002)
Preliminary study on decreasing the expression of FOXP3 with miR-155 to inhibit diffuse large B-cell lymphoma
Jincheng Z
Oncology Letters (2017)

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service