Skip to Content
Merck
All Photos(5)

Key Documents

HPA019693

Sigma-Aldrich

Anti-LSP1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-47 kDa actin-binding protein, Anti-52 kDa phosphoprotein, Anti-Lymphocyte-specific antigen WP34, Anti-Lymphocyte-specific protein 1, Anti-Protein pp52

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
R$4,140.00

R$4,140.00


Estimated to ship onMay 28, 2025



Select a Size

Change View
100 μL
R$4,140.00

About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

R$4,140.00


Estimated to ship onMay 28, 2025


biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:1000-1:2500

immunogen sequence

PRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTK

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... LSP1(4046)

General description

LSP1 (Lymphocyte-specific protein 1) is a 47kDa F-actin binding phosphoprotein consisting of mainly two domains, an N-terminal acidic domain and a C-terminal basic domain. The basic domain further is composed of multiple conserved, putative serine/threonine phosphorylation sites. In addition to these two domains, it has additional Ca2(+)-binding site.
LSP1 gene is mapped to human chromosome 11p15. It has 20 exons.

Immunogen

Lymphocyte-specific protein 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-LSP1 antibody produced in rabbit has been used in:
  • immunoprecipitation
  • western blots
  • proximity ligation assay (PLA)

Biochem/physiol Actions

LSP1 (Lymphocyte-specific protein 1) is an actin binding protein. It is phosphorylated via MAPKAPK2 (MK2) directed pathway, which further plays a vital role in the F-actin polarization during neutrophil chemotaxis.
LSP1 controls the migration of immune cell in inflammation and phagocytosis. It also modulates cell adhesion.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST74191

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Lymphocyte-specific protein 1 regulates mechanosensory oscillation of podosomes and actin isoform-based actomyosin symmetry breaking
Cervero P, et al.
Nature Communications, 9(515), 1-19 (2018)
Correlation between LSP1 polymorphisms and the susceptibility to breast cancer
Chen H, et al.
International Journal of Clinical and Experimental Pathology, 8(5), 5798-5798 (2015)
J Jongstra-Bilen et al.
Journal of immunology (Baltimore, Md. : 1950), 144(3), 1104-1110 (1990-02-01)
With use of the mouse LSP1 cDNA we isolated a human homologue of the mouse LSP1 gene from a human CTL cDNA library. The predicted protein sequence of human LSP1 is compared with the predicted mouse LSP1 protein sequence and
Yue Wu et al.
Biochemical and biophysical research communications, 358(1), 170-175 (2007-05-08)
In neutrophils, the major substrate of MAPKAPK2 (MK2) is an F-actin binding protein LSP1. Studies using mutants of the two potential Serine phosphorylation sites in LSP1 C-terminal F-actin binding region indicated that the major phosphorylation site for MK2 is Ser243

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service