Skip to Content
Merck
All Photos(6)

Key Documents

HPA014055

Sigma-Aldrich

Anti-IQGAP1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Ras GTPase-activating-like protein IQGAP1, Anti-p195

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
R$4,140.00

R$4,140.00


Check Cart for Availability


Select a Size

Change View
100 μL
R$4,140.00

About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

R$4,140.00


Check Cart for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human, mouse, rat

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

NRALESGDVNTVWKQLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... IQGAP1(8826)

General description

The gene IQGAP1 (IQ motif containing GTPase activating protein 1) encodes a calmodulin-binding protein that belongs to the IQGAP family and is ubiquitously expressed. The encoded protein contains four IQ domains and a region with sequence similarity to the Ras GTPase-activating proteins. The gene is mapped to human chromosome 15q26.1.

Immunogen

Ras GTPase-activating-like protein IQGAP1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

The gene IQGAP1 (IQ motif containing GTPase activating protein 1) encodes a key effector of Rac1 and Cdc42, Rho-family of small GTPases that regulate E-cadherin–mediated cell-cell adhesion. It functions in the modulation of actin cytoskeleton along with Rac1 and Cdc42. The encoded protein modulates cell–cell adhesion through E-cadherin and β-catenin. It participates in the regulation of mitogen activated protein kinase pathway that is involved in cell proliferation and differentiation. IQGAP1 is a scaffold protein that bridges the proteins involved in signaling cascades and participates in several cellular processes. It binds to and stabilizes microtubules via CLIP-170, a microtubule-binding protein, near the cell cortex. This results in the formation and maintenance of polarized cell morphology and directional cell migration.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72663

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Matthew D Brown et al.
Trends in cell biology, 16(5), 242-249 (2006-04-06)
IQGAP1 was identified in 1994 as a widely expressed IQ domain-containing protein with a region containing sequence similarity to the Ras GTPase-activating proteins. IQGAP1 has roles in many different aspects of cell physiology and interacts with numerous proteins. It modulates
A M Bashour et al.
The Journal of cell biology, 137(7), 1555-1566 (1997-06-30)
Activated forms of the GTPases, Rac and Cdc42, are known to stimulate formation of microfilament-rich lamellipodia and filopodia, respectively, but the underlying mechanisms have remained obscure. We now report the purification and characterization of a protein, IQGAP1, which is likely
Jun Noritake et al.
Journal of cell science, 118(Pt 10), 2085-2092 (2005-05-14)
The dynamic rearrangement of cell-cell adhesion is one of the major physiological events in tissue development and tumor metastasis. Polarized cell migration, another key event, is a tightly regulated process that occurs during tissue development, chemotaxis and wound healing. Rho-family
M A Pujana et al.
Genome research, 11(1), 98-111 (2001-01-13)
Several cytogenetic alterations affect the distal part of the long arm of human chromosome 15, including recurrent rearrangements between 12p13 and 15q25, which cause congenital fibrosarcoma (CFS). We present here the construction of a BAC/PAC contig map that spans 2

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service