Skip to Content
Merck
All Photos(5)

Key Documents

HPA008070

Sigma-Aldrich

Anti-CALCRL antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-CGRP type 1 receptor, Anti-Calcitonin gene-related peptide type 1 receptor precursor, Anti-Calcitonin receptor-like receptor

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
R$4,567.00

R$4,567.00


Check Cart for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB1267


Select a Size

Change View
100 μL
R$4,567.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

R$4,567.00


Check Cart for Availability
A recombinant, preservative-free antibody is available for your target. Try ZRB1267

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunohistochemistry: 1:50- 1:200

immunogen sequence

EDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTA

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CALCRL(10203)

General description

CALCRL (Calcitonin gene-related peptide type 1 receptor) gene is mapped to human chromosome 2q32.1 and contains 15 exons interspaced by 14 introns. Exons 1 to 3 form the non-coding region. Exons 4 through 15 comprise the coding region. The exons 8 to 14 in this region encodes seven transmembrane domains.

Immunogen

Calcitonin gene-related peptide type 1 receptor precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

CALCRL (Calcitonin gene-related peptide type 1 receptor) gene encodes a class B G protein-coupled receptor (GPCR) that forms a heterodimer complex with receptor activity-modifying protein 2 (RAMP2). This complex functions as a receptor for adrenomedullin (AM). CALCRL is activated by core glycosylation after transport from endoplasmic reticulum to the cell membrane by RAMP2. CALCRL also binds to RAMP1 and functions as a CGRP receptor. Overexpression of this protein increases the sensitivity of the sphincter muscle to endogenous AM. This causes chronic relaxation of the sphincter muscle and obstructs aqueous outflow system. Polymorphism in this gene has been linked to primary angle closure glaucoma.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71225

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

John Manion et al.
Nature, 622(7983), 611-618 (2023-09-13)
Clostridioides difficile infection (CDI) is a major cause of healthcare-associated gastrointestinal infections1,2. The exaggerated colonic inflammation caused by C. difficile toxins such as toxin B (TcdB) damages tissues and promotes C. difficile colonization3-6, but how TcdB causes inflammation is unclear. Here we report
Tse-Ming Chou et al.
The journal of headache and pain, 23(1), 157-157 (2022-12-13)
To investigate specific brain regions and neural circuits that are responsible for migraine chronification. We established a mouse model of chronic migraine with intermittent injections of clinically-relevant dose of nitroglycerin (0.1 mg/kg for 9 days) and validated the model with cephalic and
Dan Cao et al.
Molecular vision, 15, 2202-2208 (2009-11-10)
To determine whether the polymorphisms of calcitonin receptor-like receptor gene (CALCRL) are associated with primary angle closure glaucoma (PACG) in a southern Chinese population. A total of 207 individuals with acute and chronic PACG and 205 ethnically matched controls were
Seisuke Kusano et al.
Protein science : a publication of the Protein Society, 21(2), 199-210 (2011-11-22)
The calcitonin receptor-like receptor (CRLR), a class B GPCR, forms a heterodimer with receptor activity-modifying protein 2 (RAMP2), and serves as the adrenomedullin (AM) receptor to control neovascularization, while CRLR and RAMP1 form the calcitonin gene-related peptide (CGRP) receptor. Here

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service