MAB2290 is a mouse monoclonal generated to a synthetic peptide in the cytoplasmic domain of integrin alpha 3A.
Specificity
Anti-integrin alpha 3A (MAB2290) recognizes specifically the cytoplasmic domain of integrin subunit alpha 3A which is present in the basal layer in skin, glomeruli, Bowman′s capsules and distal tubuli in kidney, all vascular and capillary endothlia in brain, heart, and skin, and vascular smooth muscle cells in heart.
SPECIES REACTIVITIES:
Although untested, a braod range of species reactivity is expected due to the conserved nature of the epitope.
Immunogen
Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit alpha 3A including an additional N-terminal cysteine: CRTRALYEAKRQKAEMKSQPSETERLTDDY
Application
Anti-Integrin α3 Antibody, cytoplasmic domain, clone 29A3 is an antibody against Integrin α3 for use in WB, IC, IH.
Western Blot
Immunocytochemistry
Immunohistochemistry (Frozen Sections)
Optimal working dilutions must be determined by the end user.
Physical form
Format: Purified
Purified. Liquid in PBS containing 0.01% sodium azide.
Other Notes
Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Legal Information
CHEMICON is a registered trademark of Merck KGaA, Darmstadt, Germany
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Journal of virology, 83(11), 5329-5338 (2009-03-20)
The human adenovirus E4orf6 and E1B55K proteins promote viral replication by targeting several cellular proteins for degradation. The E4orf6 product has been shown by our group and others to form an E3 ubiquitin ligase complex that contains elongins B and
Keratinocytes form the main protective barrier in the skin to separate the underlying tissue from the external environment. In order to maintain this barrier, keratinocytes form robust junctions between neighbouring cells as well as with the underlying extracellular matrix. Cell-cell
Although human adenovirus type 5 (Ad5) has been widely studied, relatively little work has been done with other human adenovirus serotypes. The Ad5 E4orf6 and E1B55K proteins form Cul5-based E3 ubiquitin ligase complexes to degrade p53, Mre11, DNA ligase IV
Role of integrins in the assembly and function of hensin in intercalated cells.
Journal of the American Society of Nephrology null
Questions
Reviews
★★★★★ No rating value
Active Filters
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.