Skip to Content
Merck
All Photos(2)

Key Documents

HPA023861

Sigma-Aldrich

Anti-AFMID antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Synonym(s):

Anti-KF, Anti-Kynurenine formamidase, Anti-Probable arylformamidase

Sign Into View Organizational & Contract Pricing
All Photos(2)

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
HPA023861
NACRES:
NA.41

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

recombinant expression
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

VSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATRKSLLHVPYGD

UniProt accession no.

Q63HM1

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... AFMID(125061)

Related Categories

General description

AFMID, kynurenine formamidase also called arylformamidase, is located on human chromosome 17q25.3. AFMID catalyses the hydrolysis of NFK (N-formyl-L-kynurenine) to kynurenine.

Immunogen

Probable arylformamidase recombinant protein epitope signature tag (PrEST)

Application

Anti-AFMID antibody produced in rabbit may be used for the detection of AFMID protein in western blotting.

Biochem/physiol Actions

The conversion of tryptophan to nicotinic acid is catalysed by kynurenine formamidase. Alternative splicing in kynurenine formamidase gene modulates tumor suppressor p53 role in hepatocellular carcinoma development and progression. Indoleamine 2,3-dioxygenase-mediated kynurenine formation could play a role in cataract formation related to chronic inflammation.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75936

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Induction of indoleamine 2, 3-dioxygenase by interferon-gamma in human lens epithelial cells: apoptosis through the formation of 3-hydroxykynurenine
Mailankot M and Nagaraj RH
The International Journal of Biochemistry & Cell Biology, 42(9), 1446-1454 (2010)
A human-specific switch of alternatively spliced AFMID isoforms contributes to TP53 mutations and tumor recurrence in hepatocellular carcinoma
Lin KT, et al.
Genome Research, 28, 275-284 (2018)
Kynurenine formamidase: determination of primary structure and modeling-based prediction of tertiary structure and catalytic triad1
Pabarcus MK and Casida JE
Biochimica et Biophysica Acta, Protein Structure and Molecular Enzymology, 1596(2), 201-211 (2002)
Qian Han et al.
The Biochemical journal, 446(2), 253-260 (2012-06-14)
KFase (kynurenine formamidase), also known as arylformamidase and formylkynurenine formamidase, efficiently catalyses the hydrolysis of NFK (N-formyl-L-kynurenine) to kynurenine. KFase is the second enzyme in the kynurenine pathway of tryptophan metabolism. A number of intermediates formed in the kynurenine pathway

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service