HPA037986
Anti-CELF4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonym(s):
Anti-BRUNOL4, Anti-CUGBP, Elav-like family member 4
Sign Into View Organizational & Contract Pricing
All Photos(5)
About This Item
Recommended Products
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunohistochemistry: 1:200- 1:500
immunogen sequence
MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH
UniProt accession no.
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... CELF4(56853)
General description
The CUGBP Elav-like family member 4 (CELF4) codes for a RNA binding protein. It belongs to the CELF/Bruno-like family. CELF4 is also known as BRUNOL4 (bruno-like 4). It has highly conserved RNA recognition motif. This gene located on human chromosome 18.
Immunogen
CUGBP, Elav-like family member 4 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CELF4 antibody has been used in immunoprecipitation (iCLIP).
Biochem/physiol Actions
The CUGBP Elav-like family member 4 (CELF4) modulates pre-mRNA alternative splicing. It also controls splicing of human insulin receptor (IR) exon 11. CELF4 is considered as a positive regulator of human and chicken cardiac troponin T (cTNT) exon 5 alternative splicing. The encoded protein binds to RNA subsets that participates in pre- and postsynaptic neurotransmission.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST79613
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Familial 18q12.2 deletion supports the role of RNA-binding protein CELF4 in autism spectrum disorders.
Barone R, et al.
American Journal of Medical Genetics. Part A, 173(6), 1649-1655 (2017)
CELF4 Variant and Anthracycline-Related Cardiomyopathy: A Children?s Oncology Group Genome-Wide Association Study
Wang Z, et al.
Journal of Clinical Oncology, 34(8), 863?870-863?870 (2016)
Aberrant sodium channel activity in the complex seizure disorder of Celf4 mutant mice.
Sun W, et al.
The Journal of Physiology, 591(1), 241-255 (2013)
A genome-wide association study identifies a novel locus on chromosome 18q12.2 influencing white cell telomere length.
M Mangino, et al.
Journal of medical Genetics, 46(7), 451?454-451?454 (2009)
Identification of CELF splicing activation and repression domains in vivo.
Han J and Cooper TA
Nucleic Acids Research, 33(9), 2769-2780 (2005)
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service