Skip to Content
Merck
All Photos(4)

Key Documents

AV45437

Sigma-Aldrich

Anti-TAPBP antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-NGS17, Anti-TAP binding protein (tapasin), Anti-TAPA, Anti-TPN, Anti-TPSN

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

46 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... TAPBP(6892)

Immunogen

Synthetic peptide directed towards the C terminal region of human TAPBP

Application

Anti-TAPBP antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

Biochem/physiol Actions

TAP binding protein (TAPBP; tapasin) is a membrane glycoprotein that is involved in the transport of antigenic peptides across the endoplasmic membrane. The expression of tapasin is upregulated by potent inflammatory molecules such as eicosanoids. Downregulation of tapasin expression is associated with clinical outcome in primary human oral squamous cell carcinoma. Polymorphisms in TAPBP gene have been associated with the overall survival of colorectal cancer patients.

Sequence

Synthetic peptide located within the following region: GEAPPELLCLVSHFYPSGGLEVEWELRGGPGGRSQKAEGQRWLSALRHHS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jiaofang Shao et al.
PloS one, 8(8), e70307-e70307 (2013-08-14)
Recent studies have demonstrated the power of deep re-sequencing of the whole genome or exome in understanding cancer genomes. However, targeted capture of selected genomic whole gene-body regions, rather than the whole exome, have several advantages: 1) the genes can
Sung-hwan Cho et al.
Pharmacogenetics and genomics, 23(7), 341-348 (2013-06-06)
Aspirin-exacerbated respiratory disease (AERD) is characterized by the development of airway obstruction in asthmatic individuals following the ingestion of aspirin or other nonsteroidal anti-inflammatory drugs. TAPBP (TAP-binding protein, tapasin) is upregulated by eicosanoids, which act as potent inflammatory molecules in
Qian Jiang et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 31(5), 451-459 (2010-06-10)
MHC class I peptide loading complex defects are frequently observed in tumor cells which facilitate tumor cells escaping from immune surveillance. Tapasin plays an important role in the assembly of MHC class I molecules with peptides in the endoplasmic reticulum.

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service