Skip to Content
Merck
All Photos(3)

Key Documents

AV100604

Sigma-Aldrich

Anti-ETS1 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)

Sign Into View Organizational & Contract Pricing
All Photos(3)

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

50 kDa

species reactivity

dog, guinea pig, goat, rat, rabbit, human, bovine, mouse, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

NP_001137292

UniProt accession no.

P14921

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ETS1(2113)

General description

ETS1 belongs to the Ets family of transcription factors that are crucial mediators of extracellular matrix remodeling. The Ets family members are regulators of bone and cartilage development.

Immunogen

Synthetic peptide directed towards the N terminal region of human ETS1

Application

Anti-ETS1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.

Biochem/physiol Actions

The DNA-binding activity of ETS1 requires the phosphorylation at Thr38 by ERK1/2. ETS1 is expressed in a variety of cell types including hematopoietis cells, endothelial cells, epithelial cancer cells and vascular smooth muscle cells. ETS1 promotes cell invasion and angiogenesis as it regulates the transcription of VEGF and MMP genes.

Sequence

Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jürgen Dittmer
Molecular cancer, 2, 29-29 (2003-09-16)
The Ets1 proto-oncoprotein is a member of the Ets family of transcription factors that share a unique DNA binding domain, the Ets domain. The DNA binding activity of Ets1 is controlled by kinases and transcription factors. Some transcription factors, such
A Raouf et al.
Oncogene, 19(55), 6455-6463 (2001-02-15)
Bone formation in vivo is a complex phenomenon whereby recruitment and replication of mesenchymal precursors of osteoblasts, differentiation into preosteoblasts, osteoblasts, and mature osteoblasts ultimately result in the accumulation and mineralization of the extracellular matrix. MC3T3-E1, a clonal osteoblastic cell
Y Sato
Cell structure and function, 26(1), 19-24 (2001-05-10)
The ETS family of transcription factors is defined by a conserved DNA-binding ETS domain that forms a winged helix-turn-helix structural motif. This family of transcription factors is involved in a diverse array of biological functions including cellular growth and differentiation
M Trojanowska
Oncogene, 19(55), 6464-6471 (2001-02-15)
Ets factors are critical mediators of extracellular matrix (ECM) remodelling. As the spectrum of Ets-regulated target genes widens, so does their role in various pathological and physiological processes. Regulation of matrix degrading proteases by Ets factors in tumor invasion and

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service