SAB1401345
Anti-RS1 antibody produced in mouse
purified immunoglobulin, buffered aqueous solution
Synonym(s):
RS, XLRS1
About This Item
Recommended Products
1 of 4
This Item | PHR1467 | PHR3228 | 31679 |
---|---|---|---|
neat | neat | - | neat |
200 | 300 | 300 | 100 |
analytical standard | certified reference material, pharmaceutical secondary standard | certified reference material, pharmaceutical secondary standard | analytical standard |
2-8°C | 2-8°C | 2-30°C | - |
limited shelf life, expiry date on the label | - | - | limited shelf life, expiry date on the label |
General description
Immunogen
Sequence
MSRKIEGFLLLLLFGYEATLGLSSTEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA
Biochem/physiol Actions
Physical form
Disclaimer
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Need A Sample COA?
This is a sample Certificate of Analysis (COA) and may not represent a recently manufactured lot of this specific product.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service