WH0007423M3

Monoclonal Anti-VEGFB antibody produced in mouse

clone 4H5, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-VEGFL, Anti-VRF, Anti-Vascular endothelial growth factor B
• Numéro MDL: MFCD02097593
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 4H5, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2bκ
• Numéro d'accès GenBank: NM_003377
• Numéro d'accès UniProt: P49765
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... VEGFB(7423)

Description

Immunogène

VEGFB (NP_003368, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPD

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)