Accéder au contenu
Merck
Toutes les photos(5)

Principaux documents

WH0005081M3

Sigma-Aldrich

Monoclonal Anti-PAX7 antibody produced in mouse

clone 3C9, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-HUP1, Anti-paired box gene 7

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μG
416,00 €

416,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.


Sélectionner une taille de conditionnement

Changer de vue
100 μG
416,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

416,00 €


Veuillez contacter notre Service Clients pour connaître la disponibilité de ce produit.

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

3C9, monoclonal

Forme

buffered aqueous solution

Espèces réactives

mouse

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PAX7(5081)

Catégories apparentées

Description générale

Paired box 7 (PAX7) gene is located on human chromosome 1p36.13.

Immunogène

PAX7 (NP_002575.1, 411 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT

Actions biochimiques/physiologiques

Paired box 7 (PAX7) plays a key role in myogenic satellite cell specification, by blocking alternate developmental programs. Aberration in the gene expression is associated with melanoma, neuroblastoma and rhabdomyosarcoma. PAX7 participates in the formation of skeletal muscle and regeneration.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

The role of Pax genes in the development of tissues and organs: Pax3 and Pax7 regulate muscle progenitor cell functions
Buckingham, et al.
Annual Review of Cell and Developmental Biology, 23(6), 645-673 (2007)
P Seale et al.
Cell, 102(6), 777-786 (2000-10-13)
The paired box transcription factor Pax7 was isolated by representational difference analysis as a gene specifically expressed in cultured satellite cell-derived myoblasts. In situ hybridization revealed that Pax7 was also expressed in satellite cells residing in adult muscle. Cell culture
T H Beaty et al.
Human genetics, 132(7), 771-781 (2013-03-21)
A collection of 1,108 case-parent trios ascertained through an isolated, nonsyndromic cleft lip with or without cleft palate (CL/P) was used to replicate the findings from a genome-wide association study (GWAS) conducted by Beaty et al. (Nat Genet 42:525-529, 2010)

Questions

Reviews

No rating value

Active Filters

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique