WH0002027M1

Monoclonal Anti-ENO3 antibody produced in mouse

clone 5D1, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-MSE, Anti-enolase 3 (beta, muscle)
• Numéro MDL: MFCD02262581
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 5D1, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotype: IgG2aκ
• Numéro d'accès GenBank: NM_001976
• Numéro d'accès UniProt: P13929
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Informations sur le gène: human ... ENO3(2027)

Description

Description générale

ENO3 (enolase 3) gene codes for enolase enzyme. This isoenzyme is present in skeletal and cardiac muscle cells. This gene is located on human chromosome 17pter-p11 b.

This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in skeletal muscle cells in the adult. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene can be associated with metabolic myopathies that may result from decreased stability of the enzyme. Two transcripts have been identified for this gene that differ only in their 5′ UTR. (provided by RefSeq)

Immunogène

ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG

Actions biochimiques/physiologiques

Mutations in ENO3 (enolase 3) is linked with metabolic myopathies that may occur due to decreased stability of the enzyme. It catalyses the interconversion of 2-phosphoglycerate and phosphoenolpyruvate. ENO3 possess several methylation properties.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 12 - Non Combustible Liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)