WH0001978M1

Monoclonal Anti-EIF4EBP1 antibody produced in mouse

clone 4F3-H2, purified immunoglobulin, buffered aqueous solution

• Synonyme(s) : Anti-4EBP1, Anti-PHASI, Anti-eukaryotic translation initiation factor 4E binding protein 1
• Numéro MDL: MFCD01865141
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: mouse
• Conjugué: unconjugated
• Forme d'anticorps: purified immunoglobulin
• Type de produit anticorps: primary antibodies
• Clone: 4F3-H2, monoclonal
• Forme: buffered aqueous solution
• Espèces réactives: human
• Technique(s): immunofluorescence: suitable; indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• Isotype: IgG1κ
• Numéro d'accès GenBank: BC004459
• Numéro d'accès UniProt: Q13541
• Conditions d'expédition: dry ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... EIF4EBP1(1978)

Description

Description générale

This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5′ end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. (provided by RefSeq)

Immunogène

EIF4EBP1 (AAH04459, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

Actions biochimiques/physiologiques

The gene EIF4EBP1 (eukaryotic translation initiation factor 4E binding protein 1) encodes a translation repressor that interacts with eukaryotic translation initiation factor 4E (eIF4E). eIF4E is a multisubunit complex that recruits 40S ribosomal subunits to the 5′ end of mRNA. The interaction of the encoded binding protein with this complex inhibits translation. The phosphorylation of eIF4Ebp1 in response to stimuli such as, UV irradiation and insulin signaling, results in dissociation of this factor from the eIF4E complex, leading to initiation of translation of mRNA. The encoded protein participates in cell proliferation, apoptosis, invasion, and metastasis. It functions as an effector molecule in mTOR (mammalian target of rapamycin complex 1) signaling pathway that regulates protein synthesis. It is found to be overexpressed in hepatocellular carcinoma tissues and serves as a potential prognostic and therapeutic target.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)