SAB5702738

Anti-LIN28A Antibody, clone 2S1I10, Rabbit Monoclonal

• Synonyme(s) : CSDD1, LIN-28, LIN28, ZCCHC1, lin-28A
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 2S1I10, monoclonal
• Forme: liquid
• Poids mol.: 26 kDa
• Espèces réactives: human, rat, rat
• Concentration: 0.70 mg/mL
• Technique(s): immunofluorescence: 1:50 - 1:200; western blot: 1:10000 - 1:20000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKS
• Numéro d'accès UniProt: Q9H9Z2
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... LIN28A(79727)

Description

Description générale

This gene encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in developmental timing and self-renewal in embryonic stem cells. The encoded protein functions through direct interaction with target mRNAs and by disrupting the maturation of certain miRNAs involved in embryonic development. This protein prevents the terminal processing of the LET7 family of microRNAs which are major regulators of cellular growth and differentiation. Aberrant expression of this gene is associated with cancer progression in multiple tissues. [provided by RefSeq, Sep 2015]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human LIN28A (Q9H9Z2).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IF/ICC

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1