SAB5702326

Anti-NUDEL/NDEL1 Antibody, clone 9C8T10, Rabbit Monoclonal

• Synonyme(s) : EOPA, MITAP1, NDE1L1, NDE2, NUDEL
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 9C8T10, monoclonal
• Forme: liquid
• Poids mol.: 40 kDa
• Espèces réactives: rat, rat, human
• Concentration: 0.35 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MDGEDIPDFSSLKEETAYWKELSLKYKQSFQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVEALKEKLEHQYAQSYKQVSVLEDD
• Numéro d'accès UniProt: Q9GZM8
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NDEL1(81565)

Description

Description générale

This gene encodes a coiled-coil protein that plays a role in multiple processes including cytoskeletal organization, cell signaling and neuron migration, outgrowth and maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, Mar 2012]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUDEL/NDEL1 (Q9GZM8).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1